PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G26240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 389aa    MW: 40659.3 Da    PI: 6.5981
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G26240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.3e-18260294135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  LPERR01G26240.1 260 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 294
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.0E-7017345IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.453254290IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.5E-15254291IPR013088Zinc finger, NHR/GATA-type
SMARTSM004011.3E-18254304IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-15256317No hitNo description
CDDcd002021.60E-14259310No hitNo description
PfamPF003201.4E-15260294IPR000679Zinc finger, GATA-type
PROSITE patternPS003440260285IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEATPEYGVH GGGGYYGGAG REKKAQGCGD HFAVDDLLVL PYDEEDEGRE GDAGGGKEEA  60
GFGNASADSS TVTALDSCSN SFGLADGDFS GELCEPYDQL AELEWLSNYM GEGVDTFATE  120
DLQKLQLISG IPSGGFSTAN VLSAQAASAA ASAAVQPGGF LPEAPVPAKA RSKRSRAAPG  180
NWSSRLLVLP PPPASPPSPA SMAISPAESG VSAHAFPIKR PSKPAKKKDA PAPQAQQLSS  240
VVPMHSGGGS PAAAGEGRRC LHCETDKTPQ WRTGPMGPKT LCNACGVRYK SGRLVPEYRP  300
AASPTFMVSK HSNSHRKVLE LRRQKEMHEP HQLHHHQHHV AAGAGGGVGS LMHSMQSAML  360
FDGAASSPVV SGEDFLIHHH LGTDFRQLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218960.0AK121896.1 Oryza sativa Japonica Group cDNA clone:J033105E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631175.10.0PREDICTED: GATA transcription factor 12
TrEMBLA0A0D9V5J80.0A0A0D9V5J8_9ORYZ; Uncharacterized protein
STRINGORGLA01G0250200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-49GATA transcription factor 12